Question Paper - Preliminary Screening
-
Write an excel formula / macro or basic algorithm / logic statement in any programming language to calculate number of unique lactobacillus strains?
-
This question paper comprises of three sections – Comprehension, Subject based MCQ and General awareness. Answer the questions below by clicking the button next to the best answer or typing your answer. The questions in comprehension section are based on the content of a technology passage. After reading the passage, choose / write the best answer to each question. Answer See moreall questions following the passage on the basis of what is stated or inferred in the passage.
Quiz Preview
- 2.
Write a excel formula / macro or basic algorithm / logic statement in any programming language to calculate type of biocontrol agents disclosed in above stated technology disclosure.
- 3.
Assume you are appointed as a sales head of Novo biotech, Bangalore. As your first job assignment, you need to estimate the number of DNA isolation kits sold per month in Bangalore. Write your guesstimation approach briefly in a step wise manner?
- 4.
Write a code in C / Perl / Python to extract ABC transporter domain (most conserved) in following bacterial sequences ?PRVPDTHMDRDSLLSDRDTHGDVVDEKATAPRVPDTHIYLRSVFQSHLETLGGSSVQVHLEAELAYPRVPDTHTQKTIGEDESATHLLAHLEVLVKATAVKVHLYDTEPRVPDTH
- 5.
Write a code in C / Perl / Python to print following pattern on screen ?*****************
- 6.
Novozymes acquired enzyme business of which Indian company?
-
Advance Enzyme
-
Biocon
-
Praj Industries
-
DuPont
Correct Answer
A. BioconExplanation
Novozymes acquired the enzyme business of Biocon, an Indian company.Rate this question:
-
- 7.
Which is / are the merger & acquisitions happened in the biotechnology industry:
-
DuPont & Dow Chemical
-
Syngenta & ChemChina
-
Bayer & Monsanto
-
1 & 3
-
All of the above
Correct Answer
A. All of the aboveExplanation
The correct answer is "All of the above" because all three mergers and acquisitions listed (DuPont & Dow Chemical, Syngenta & ChemChina, and Bayer & Monsanto) have occurred in the biotechnology industry.Rate this question:
-
- 8.
Is "Solar cooker" a patentable invention?
-
Yes
-
No
-
Yes but only with additional novel elements
-
No because it’s based on natural phenomena
Correct Answer
A. Yes but only with additional novel elementsExplanation
The correct answer is "Yes but only with additional novel elements." This means that a solar cooker can be considered a patentable invention, but only if it includes additional unique and innovative elements. Simply using solar energy to cook food may not be enough to qualify for a patent, but if the solar cooker incorporates new and inventive features, it may be eligible for patent protection.Rate this question:
-
- 9.
Which of the following inventions are patentable?
-
Naturally occurring microbes
-
Non-naturally occurring microbes
-
GMO organisms
-
Synthetic Cells
-
2, 3 & 4
-
All of the above
Correct Answer
A. 2, 3 & 4Explanation
The correct answer is 2, 3 & 4 because naturally occurring microbes cannot be patented as they are not inventions. However, non-naturally occurring microbes, GMO organisms, and synthetic cells can be patented as they are man-made inventions that are not naturally occurring.Rate this question:
-
- 10.
How many different linear tetrapeptides can be made from four different neutral amino acids (a) using any of the four amino acids for any position (repletion allowed) (b) using amino acid only once in a chain?
-
24 & 64
-
256 & 24
-
64 & 24
-
64 & 64
Correct Answer
A. 256 & 24 -
- 11.
The Molecular Weight of bacteriophage DNA is 1.5 X 108 (double stranded). How many amino acids can be coded by phage DNA? (average weight of DNA basepair is 618)
-
8k codons
-
80k codons
-
800k codons
-
800 codons
Correct Answer
A. 80k codonsExplanation
The molecular weight of the bacteriophage DNA is given as 1.5 X 10^8. The average weight of a DNA base pair is given as 618. To calculate the number of amino acids that can be coded by the phage DNA, we need to divide the molecular weight of the DNA by the weight of a single base pair. This gives us 1.5 X 10^8 / 618 = 242573. Since each codon codes for a single amino acid, the number of codons that can be coded by the phage DNA is equal to the number of amino acids, which is approximately 242573. Therefore, the correct answer is 80k codons, as 80k is the closest option to 242573.Rate this question:
-
- 12.
CRISPR is "Clustered regularly interspaced short palindromic repeats" discovered in prokaryotes:(A) CRISPR related to bacterial defense / immune system(B) CRISPR can use in gene therapies, enzyme modification, bio-agricuture applicationsSelect the appropriate response:
-
A – Correct, B – Partially correct
-
A & B – Both are correct
-
A & B - Partially Correct
-
A – Correct, B – wrong
Correct Answer
A. A & B – Both are correctExplanation
CRISPR, which stands for "Clustered regularly interspaced short palindromic repeats," was discovered in prokaryotes. It is correct to say that CRISPR is related to the bacterial defense/immune system, as it plays a crucial role in protecting bacteria from viral infections. Additionally, it is also correct to say that CRISPR can be used in gene therapies, enzyme modification, and bio-agriculture applications, as it has revolutionized the field of genetic engineering and has immense potential in various applications. Therefore, both options A and B are correct.Rate this question:
-
- 13.
Recombinant frequency for aabb and AABB gametes:
-
27 m.u
-
5.8 m.u
-
3.1 m.u
-
22 m.u
Correct Answer
A. 5.8 m.uExplanation
The recombinant frequency for aabb and AABB gametes is 5.8 m.u. Recombinant frequency refers to the percentage of offspring that show a combination of traits different from those of the parents. In this case, the recombinant frequency suggests that 5.8% of the offspring will have traits that differ from both the aabb and AABB gametes. This indicates a certain level of genetic recombination occurring during the formation of gametes.Rate this question:
-
- 14.
Probability of co-occurrence of aa and bb genes in the progeny population:
-
.22
-
.18
-
.03
-
.40
Correct Answer
A. .40Explanation
The probability of co-occurrence of aa and bb genes in the progeny population is .40. This means that there is a 40% chance that both aa and bb genes will be present in the offspring.Rate this question:
-
- 15.
Probability of co-occurrence of AABB or AAbb genes in the progeny population:
-
.53
-
.56
-
.27
-
.18
Correct Answer
A. .56Explanation
The probability of co-occurrence of AABB or AAbb genes in the progeny population is .56. This means that there is a 56% chance that either AABB or AAbb genes will be present in the offspring.Rate this question:
-
- 16.
What is the pH of 10-8 N HCL solution?
-
8
-
Between 8 and 9
-
Between 7 and 8
-
Between 6 and 7
Correct Answer
A. Between 6 and 7Explanation
The pH of a solution is a measure of its acidity or alkalinity. A pH value between 6 and 7 indicates that the solution is slightly acidic. Since HCl is a strong acid, it completely dissociates in water to form H+ ions. Therefore, a 10-8 N HCl solution will have a high concentration of H+ ions, resulting in a slightly acidic pH value between 6 and 7.Rate this question:
-
- 17.
Above invention could be used in the treatment of:
-
Cardio-vascular disorders
-
Obesity
-
Hypolipoproteinemia
-
1 & 2
-
All of the above
Correct Answer
A. All of the aboveExplanation
The above invention could be used in the treatment of cardio-vascular disorders, obesity, and hypolipoproteinemia. This means that it has potential applications in treating various conditions related to the heart, weight management, and low levels of lipoproteins in the blood.Rate this question:
-
- 18.
Which of the above stated technology statement discloses application of exogenous RNA / dsRNA for bio-agriculture application ?
-
A, B & C
-
A & C
-
Only A
-
None of the above
Correct Answer
A. A & CExplanation
The correct answer is A & C because both statements A and C mention the application of exogenous RNA / dsRNA in bio-agriculture.Rate this question:
-
- 19.
Focus of the above stated invention is:
-
Novel compositions
-
Novel bacterial strains
-
Novel composition containing bacterial strains
-
All of the above
Correct Answer
A. Novel composition containing bacterial strainsExplanation
The focus of the above-stated invention is a novel composition containing bacterial strains. This means that the invention involves a new combination or formulation of bacterial strains that has not been previously used or discovered. The invention may have identified specific bacterial strains that have unique properties or characteristics, and the composition containing these strains could have potential applications in various fields such as medicine, agriculture, or environmental science.Rate this question:
-
Quiz Review Timeline (Updated): Mar 19, 2023 +
Our quizzes are rigorously reviewed, monitored and continuously updated by our expert board to maintain accuracy, relevance, and timeliness.
-
Current Version
-
Mar 19, 2023Quiz Edited by
ProProfs Editorial Team -
Jul 18, 2017Quiz Created by
Amitabh Gupta
Back to top